PDB entry 1iue

View 1iue on RCSB PDB site
Description: Crystal Structure Analysis of ferredoxin from Plasmodium falciparum
Class: electron transport
Keywords: Electron transport, Iron-sulfur
Deposited on 2002-03-04, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IED5 (1-97)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1iuea1, d1iuea2
  • Chain 'B':
    Compound: ferredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IED5 (1-97)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1iueb1, d1iueb2
  • Heterogens: NA, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iueA (A:)
    afynitlrtndgekkiecnedeyildaserqnvelpyscrggscstcaaklvegevdndd
    qsyldeeqikkkyillctcypksdcviethkedelhdm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iueB (B:)
    afynitlrtndgekkiecnedeyildaserqnvelpyscrggscstcaaklvegevdndd
    qsyldeeqikkkyillctcypksdcviethkedelhdm