PDB entry 1iua

View 1iua on RCSB PDB site
Description: Ultra-high resolution structure of HiPIP from Thermochromatium tepidum
Class: electron transport
Keywords: HiPIP, ultra-high resolution, crystal structure, ELECTRON TRANSPORT
Deposited on 2002-03-01, released 2002-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: 0.101
AEROSPACI score: 1.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iuaa_
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iuaA (A:)
    aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
    cqlfpgklinvngwcaswtlkag