PDB entry 1iu6

View 1iu6 on RCSB PDB site
Description: neutron crystal structure of the rubredoxin mutant from pyrococcus furiosus
Deposited on 2002-02-27, released 2002-08-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-27, with a file datestamp of 2002-08-27.
Experiment type: NEUT
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1iu6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iu6A (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekle