PDB entry 1iu3

View 1iu3 on RCSB PDB site
Description: crystal structure of the e.coli seqa protein complexed with hemimethylated DNA
Class: replication inhibitor/DNA
Keywords: Protein-DNA complex, Recognition of hemimethylated DNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, REPLICATION INHIBITOR/DNA COMPLEX
Deposited on 2002-02-26, released 2003-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*ap*gp*gp*ap*tp*cp*cp*ap*a)-3'
    Species:
    Gene:
  • Chain 'B':
    Compound: 5'-d(*tp*tp*gp*gp*ap*tp*cp*cp*tp*t)-3'
    Species:
    Gene:
  • Chain 'C':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (5-115)
      • cloning artifact (1-4)
    Domains in SCOPe 2.06: d1iu3c1, d1iu3c2
  • Chain 'D':
    Compound: 5'-d(*ap*ap*gp*gp*ap*tp*cp*cp*ap*a)-3'
    Species:
    Gene:
  • Chain 'E':
    Compound: 5'-d(*tp*tp*gp*gp*ap*tp*cp*cp*tp*t)-3'
    Species:
    Gene:
  • Chain 'F':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (5-115)
      • cloning artifact (1-4)
    Domains in SCOPe 2.06: d1iu3f1, d1iu3f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iu3C (C:)
    gplgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaade
    qtllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu3C (C:)
    plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeq
    tllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iu3F (F:)
    gplgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaade
    qtllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu3F (F:)
    plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeq
    tllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti