PDB entry 1iu1

View 1iu1 on RCSB PDB site
Description: Crystal structure of human gamma1-adaptin ear domain
Class: endocytosis
Keywords: Coated pits, ENDOCYTOSIS
Deposited on 2002-02-19, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma1-adaptin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iu1a_
  • Chain 'B':
    Compound: gamma1-adaptin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iu1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iu1A (A:)
    svpqisqphflldglssqplfndiaagipsitaysknglkieftfersntnpsvtvitiq
    asnsteldmtdfvfqaavpktfqlqllspsssivpafntgtitqvikvlnpqkqqlrmri
    kltynhkgsamqdlaevnnfppqswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu1A (A:)
    gipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
    lspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iu1B (B:)
    svpqisqphflldglssqplfndiaagipsitaysknglkieftfersntnpsvtvitiq
    asnsteldmtdfvfqaavpktfqlqllspsssivpafntgtitqvikvlnpqkqqlrmri
    kltynhkgsamqdlaevnnfppqswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu1B (B:)
    iaagipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfq
    lqllspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppq
    swq