PDB entry 1itz

View 1itz on RCSB PDB site
Description: Maize Transketolase in complex with TPP
Class: transferase
Keywords: Calvin cycle, Transketolase, Zea mays, Cofactor, Thiamine pyrophosphate, Plant, TRANSFERASE
Deposited on 2002-02-15, released 2003-02-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1itza1, d1itza2, d1itza3
  • Chain 'B':
    Compound: transketolase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1itzb1, d1itzb2, d1itzb3
  • Chain 'C':
    Compound: transketolase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1itzc1, d1itzc2, d1itzc3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1itzA (A:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzA (A:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1itzB (B:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzB (B:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1itzC (C:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzC (C:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf