PDB entry 1ity

View 1ity on RCSB PDB site
Description: Solution structure of the DNA binding domain of human TRF1
Class: DNA binding protein
Keywords: helix-turn-helix, telomeres, DNA binding, Myb domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2002-02-15, released 2002-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trf1
    Species: Homo sapiens [TaxId:9606]
    Gene: TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1itya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ityA (A:)
    tpekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
    klissdsed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ityA (A:)
    ekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklkl
    issdsed