PDB entry 1ity

View 1ity on RCSB PDB site
Description: solution structure of the dna binding domain of human trf1
Deposited on 2002-02-15, released 2002-03-06
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1itya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ityA (A:)
tpekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
klissdsed

    Sequence, based on observed residues (ATOM records): (download) 
    >1ityA (A:)
ekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklkl
issdsed