PDB entry 1itx

View 1itx on RCSB PDB site
Description: Catalytic Domain of Chitinase A1 from Bacillus circulans WL-12
Deposited on 2002-02-13, released 2002-03-13
The last revision prior to the SCOP 1.67 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itxA (A:)
    lqpataeaadsykivgyypswaaygrnynvadidptkvthinyafadicwngihgnpdps
    gpnpvtwtcqneksqtinvpngtivlgdpwidtgktfagdtwdqpiagninqlnklkqtn
    pnlktiisvggwtwsnrfsdvaataatrevfansavdflrkynfdgvdldweypvsggld
    gnskrpedkqnytlllskirekldaagavdgkkylltiasgasatyaantelakiaaivd
    winimtydfngawqkisahnaplnydpaasaagvpdantfnvaagaqghldagvpaaklv
    lgvpfygrgwdgcaqagngqyqtctggssvgtweagsfdfydleanyinkngytrywndt
    akvpylynasnkrfisyddaesvgyktayikskglggamfwelsgdrnktlqnklkadl