PDB entry 1itx

View 1itx on RCSB PDB site
Description: Catalytic Domain of Chitinase A1 from Bacillus circulans WL-12
Class: hydrolase
Keywords: Alpha-Beta (TIM) Barrel, HYDROLASE
Deposited on 2002-02-13, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyl hydrolase
    Species: Bacillus circulans [TaxId:1397]
    Gene: CHIA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1itxa1, d1itxa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itxA (A:)
    lqpataeaadsykivgyypswaaygrnynvadidptkvthinyafadicwngihgnpdps
    gpnpvtwtcqneksqtinvpngtivlgdpwidtgktfagdtwdqpiagninqlnklkqtn
    pnlktiisvggwtwsnrfsdvaataatrevfansavdflrkynfdgvdldweypvsggld
    gnskrpedkqnytlllskirekldaagavdgkkylltiasgasatyaantelakiaaivd
    winimtydfngawqkisahnaplnydpaasaagvpdantfnvaagaqghldagvpaaklv
    lgvpfygrgwdgcaqagngqyqtctggssvgtweagsfdfydleanyinkngytrywndt
    akvpylynasnkrfisyddaesvgyktayikskglggamfwelsgdrnktlqnklkadl