PDB entry 1itw

View 1itw on RCSB PDB site
Description: Crystal structure of the monomeric isocitrate dehydrogenase in complex with isocitrate and Mn
Class: oxidoreductase
Keywords: Greece key motif, OXIDOREDUCTASE
Deposited on 2002-02-12, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100 (Start-740)
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1itwa_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100 (Start-740)
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1itwb_
  • Chain 'C':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1itwc_
  • Chain 'D':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100 (Start-740)
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1itwd_
  • Heterogens: MN, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1itwA (A:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itwA (A:)
    stpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqk
    isddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekd
    vkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdf
    ygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeie
    dakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdly
    ariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsg
    kmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeyg
    shdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratn
    tpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisv
    tgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrw
    dslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshf
    ylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntd
    ltskamrpsatfnaalapla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1itwB (B:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itwB (B:)
    stpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqk
    isddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekd
    vkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdf
    ygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeie
    dakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdly
    ariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsg
    kmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeyg
    shdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratn
    tpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisv
    tgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrw
    dslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshf
    ylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntd
    ltskamrpsatfnaalapla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1itwC (C:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itwC (C:)
    stpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqk
    isddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekd
    vkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdf
    ygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeie
    dakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdly
    ariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsg
    kmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeyg
    shdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratn
    tpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisv
    tgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrw
    dslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshf
    ylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntd
    ltskamrpsatfnaalapl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1itwD (D:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itwD (D:)
    stpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqk
    isddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekd
    vkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdf
    ygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeie
    dakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdly
    ariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsg
    kmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeyg
    shdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratn
    tpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisv
    tgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrw
    dslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshf
    ylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntd
    ltskamrpsatfnaalapla