PDB entry 1itp

View 1itp on RCSB PDB site
Description: Solution Structure of POIA1
Class: protein binding
Keywords: inhibitor, propeptide, beta-alpha-beta, PROTEIN BINDING
Deposited on 2002-01-23, released 2002-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase A inhibitor 1
    Species: Pleurotus ostreatus [TaxId:5322]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M4T6 (1-76)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1itpa1, d1itpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itpA (A:)
    gsagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqgl
    qgdlidsieedgivttq