PDB entry 1itp

View 1itp on RCSB PDB site
Description: Solution Structure of POIA1
Class: protein binding
Keywords: inhibitor, propeptide, beta-alpha-beta, PROTEIN BINDING
Deposited on 2002-01-23, released 2002-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: proteinase A inhibitor 1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M4T6 (1-76)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1itpa1, d1itpa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1itpA (A:)
  gsagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqgl
  qgdlidsieedgivttq