PDB entry 1itl

View 1itl on RCSB PDB site
Description: human interleukin 4: the solution structure of a four-helix-bundle protein
Class: cytokine
Keywords: cytokine
Deposited on 1992-02-08, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1itla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itlA (A:)
    mhkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshh
    ekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlkti
    mrekyskcss