PDB entry 1itk

View 1itk on RCSB PDB site
Description: Crystal structure of catalase-peroxidase from Haloarcula marismortui
Deposited on 2002-01-18, released 2002-08-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1itkA (A:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
    wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
    dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdad
    ydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwe
    vnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipf
    epgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltal
    iggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtge
    vkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itkA (A:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnknmitsgiegpwtqsptewdmgyin
    nlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkrdpdyrev
    metfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdadydligde
    eiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwevnepeql
    etvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipfepgrvda
    gpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltaliggmrsi
    ganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtgevkweatr
    idlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itkB (B:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
    wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
    dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdad
    ydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwe
    vnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipf
    epgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltal
    iggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtge
    vkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle