PDB entry 1itk

View 1itk on RCSB PDB site
Description: Crystal structure of catalase-peroxidase from Haloarcula marismortui
Class: oxidoreductase
Keywords: heme protein, oxidoreductase
Deposited on 2002-01-18, released 2002-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1itka1, d1itka2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1itkb1, d1itkb2
  • Heterogens: SO4, CL, UNX, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1itkA (A:)
    maetpnsdmsgatggrskrpksnqdwwpsklnleildqnardvgpveddfdyaeefqkld
    leavksdleelmtssqdwwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapi
    nswpdnanldkarrlllpikqkygqkiswadlmilagnvaiesmgfktfgyaggredafe
    edkavnwgpedefetqerfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqt
    fdrmamndketaaliagghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskgg
    emitsgiegpwtqsptewdmgyinnlldyewepekgpggawqwapkseelknsvpdahdp
    dekqtpmmlttdialkrdpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgp
    evpdeemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkr
    ggangarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggna
    aveqaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevl
    vdnadllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewep
    aadsehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtws
    kvmkldrfdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itkA (A:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnknmitsgiegpwtqsptewdmgyin
    nlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkrdpdyrev
    metfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdadydligde
    eiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwevnepeql
    etvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipfepgrvda
    gpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltaliggmrsi
    ganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtgevkweatr
    idlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1itkB (B:)
    maetpnsdmsgatggrskrpksnqdwwpsklnleildqnardvgpveddfdyaeefqkld
    leavksdleelmtssqdwwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapi
    nswpdnanldkarrlllpikqkygqkiswadlmilagnvaiesmgfktfgyaggredafe
    edkavnwgpedefetqerfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqt
    fdrmamndketaaliagghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskgg
    emitsgiegpwtqsptewdmgyinnlldyewepekgpggawqwapkseelknsvpdahdp
    dekqtpmmlttdialkrdpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgp
    evpdeemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkr
    ggangarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggna
    aveqaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevl
    vdnadllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewep
    aadsehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtws
    kvmkldrfdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itkB (B:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
    wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
    dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdad
    ydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwe
    vnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipf
    epgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltal
    iggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtge
    vkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle