PDB entry 1iti

View 1iti on RCSB PDB site
Description: the high resolution three-dimensional solution structure of human interleukin-4 determined by multi-dimensional heteronuclear magnetic resonance spectroscopy
Class: cytokine
Keywords: interleukin-4, cytokine
Deposited on 1993-04-12, released 1993-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-4
  Species: Homo sapiens [TaxId:9606]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05112 (4-132)
    • conflict (41)
    • conflict (108)
  Domains in SCOPe 2.02: d1itia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1itiA (A:)
  eaeahkcditlqeiiktlnslteqktlcteltvtdifaaskdtteketfcraatvlrqfy
  shhekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeadqstlenflerl
  ktimrekyskcss