PDB entry 1iti

View 1iti on RCSB PDB site
Description: the high resolution three-dimensional solution structure of human interleukin-4 determined by multi-dimensional heteronuclear magnetic resonance spectroscopy
Deposited on 1993-04-12, released 1993-07-15
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-15, with a file datestamp of 2001-02-15.
Experiment type: -
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1iti__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iti_ (-)
  eaeahkcditlqeiiktlnslteqktlcteltvtdifaaskdtteketfcraatvlrqfy
  shhekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeadqstlenflerl
  ktimrekyskcss