PDB entry 1ith

View 1ith on RCSB PDB site
Description: structure determination and refinement of homotetrameric hemoglobin from urechis caupo at 2.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-12-03, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.147
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (cyano met)
    Species: Urechis caupo [TaxId:6431]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06148 (0-140)
      • conflict (3)
    Domains in SCOPe 2.08: d1itha_
  • Chain 'B':
    Compound: hemoglobin (cyano met)
    Species: Urechis caupo [TaxId:6431]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06148 (0-140)
      • conflict (3)
    Domains in SCOPe 2.08: d1ithb_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ithA (A:)
    gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
    ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
    adpttvaawgdaagvlvaamk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ithB (B:)
    gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
    ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
    adpttvaawgdaagvlvaamk