PDB entry 1it9

View 1it9 on RCSB PDB site
Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a
Deposited on 2002-01-11, released 2003-02-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it9H (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmqwvkqapgqglewmgeidpsdsytny
    nqkfkgkatltvdtststaymelsslrsedtavyycarnrdysnnwyfdvwgegtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it9L (L:)
    eivltqspgtlslspgeratlsckasqsvdydgdsymnwyqqkpgqaprlliyaasnles
    gipdrfsgsgsgtdftltisrlepedfavyycqqsnedprtfgqgtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfn