PDB entry 1it9

View 1it9 on RCSB PDB site
Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a
Class: immune system
Keywords: immunoglobulin, fab, anti_fas, agonistic_antibody, apoptosis, antibody_humanization, immune system
Deposited on 2002-01-11, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: humanized antibody hfe7a, heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1it9h1, d1it9h2
  • Chain 'L':
    Compound: humanized antibody hfe7a, light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1it9l1, d1it9l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it9H (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmqwvkqapgqglewmgeidpsdsytny
    nqkfkgkatltvdtststaymelsslrsedtavyycarnrdysnnwyfdvwgegtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it9L (L:)
    eivltqspgtlslspgeratlsckasqsvdydgdsymnwyqqkpgqaprlliyaasnles
    gipdrfsgsgsgtdftltisrlepedfavyycqqsnedprtfgqgtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfn