PDB entry 1it5

View 1it5 on RCSB PDB site
Description: Solution structure of apo-type PLA2 from Streptomyces violaceruber A-2688.
Class: hydrolase
Keywords: Prokaryotic PLA2, HYDROLASE
Deposited on 2002-01-09, released 2002-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Streptomyces violaceoruber [TaxId:1935]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6UV28 (0-119)
  Domains in SCOPe 2.08: d1it5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1it5A (A:)
  apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
  carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
  fg