PDB entry 1it3

View 1it3 on RCSB PDB site
Description: Hagfish CO ligand hemoglobin
Deposited on 2002-01-05, released 2002-01-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1it3a_
  • Chain 'B':
    Domains in SCOP 1.71: d1it3b_
  • Chain 'C':
    Domains in SCOP 1.71: d1it3c_
  • Chain 'D':
    Domains in SCOP 1.71: d1it3d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it3A (A:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it3B (B:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it3C (C:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it3D (D:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay