PDB entry 1it2

View 1it2 on RCSB PDB site
Description: Hagfish deoxy hemoglobin
Deposited on 2002-01-05, released 2002-01-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1it2a_
  • Chain 'B':
    Domains in SCOP 1.71: d1it2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it2A (A:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it2B (B:)
    piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
    nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
    fvstidggaefeklfsiicillrsay