PDB entry 1it1

View 1it1 on RCSB PDB site
Description: Solution structures of ferrocytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: electron transport
Keywords: electron transfer, tetraheme protein, ELECTRON TRANSPORT
Deposited on 2001-12-29, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1it1a_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1it1A (A:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs