PDB entry 1isy

View 1isy on RCSB PDB site
Description: Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with glucose
Class: hydrolase
Keywords: alpha-beta barrel, protein-sugar complex, carbohydrate binding domain, hydrolase
Deposited on 2001-12-27, released 2002-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1isya1, d1isya2
  • Chain 'B':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1isyb1, d1isyb2
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isyA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isyB (B:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt