PDB entry 1isx

View 1isx on RCSB PDB site
Description: Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylotriose
Class: hydrolase
Keywords: alpha-beta barrel, protein-sugar complex, carbohydrate binding domain, hydrolase
Deposited on 2001-12-27, released 2002-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1isxa1, d1isxa2
  • Chain 'B':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1isxb1, d1isxb2
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isxA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isxB (B:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt