PDB entry 1isw

View 1isw on RCSB PDB site
Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with xylobiose
Deposited on 2001-12-27, released 2002-02-20
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iswA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iswB (B:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt