PDB entry 1ist

View 1ist on RCSB PDB site
Description: Crystal structure of yeast cyclophilin A, CPR1
Class: isomerase
Keywords: BARREL, Cyclosporin
Deposited on 2001-12-25, released 2003-11-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ista_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1istb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1istA (A:)
    msqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfml
    qggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwl
    dgkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1istA (A:)
    sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
    ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
    gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1istB (B:)
    msqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfml
    qggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwl
    dgkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1istB (B:)
    sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
    ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
    gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel