PDB entry 1iss

View 1iss on RCSB PDB site
Description: Crystal Structure of Metabotropic Glutamate Receptor Subtype 1 Complexed with an antagonist
Class: signaling protein
Keywords: signal transduction, neurotransmitter, g protein coupled receptor, antagonist, 4-carboxyphenylglycine, signaling protein
Deposited on 2001-12-21, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.257
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metabotropic glutamate receptor subtype 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1issa_
  • Chain 'B':
    Compound: metabotropic glutamate receptor subtype 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1issb_
  • Heterogens: MCG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1issA (A:)
    ssqrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinad
    pvllpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrt
    kkpiagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqa
    ramldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdr
    llrklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyev
    eanggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkk
    vctgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklld
    flikssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki
    qmnksgmvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1issA (A:)
    rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
    lpnitlgseirdscwhssvaleqsiefirdslikpiagvigpgsssvaiqvqnllqlfdi
    pqiaysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesg
    mdafkelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgll
    samrrlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrld
    tntrnpwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyam
    ahglqnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgryd
    imnlqyteanrydyvhvgtwhegvlniddyki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1issB (B:)
    ssqrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinad
    pvllpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrt
    kkpiagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqa
    ramldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdr
    llrklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyev
    eanggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkk
    vctgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklld
    flikssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki
    qmnksgmvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1issB (B:)
    rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
    lpnitlgseirdscwhssvaleqsiefirdslikpiagvigpgsssvaiqvqnllqlfdi
    pqiaysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesg
    mdafkelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgll
    samrrlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrld
    tntrnpwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyam
    ahglqnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgryd
    imnlqyteanrydyvhvgtwhegvlniddyki