PDB entry 1isp

View 1isp on RCSB PDB site
Description: Crystal structure of Bacillus subtilis lipase at 1.3A resolution
Class: hydrolase
Keywords: alpha/beta hydrolase fold
Deposited on 2001-12-19, released 2002-12-19
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.192
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Bacillus subtilis
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ispa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ispA (A:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ispA (A:)
    ehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqk
    vldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnq
    kilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt