PDB entry 1iso

View 1iso on RCSB PDB site
Description: isocitrate dehydrogenase: structure of an engineered nadp+--> nad+ specificity-reversal mutant
Class: oxidoreductase
Keywords: nadp, phosphorylation, glyoxylate bypass, oxidoreductase
Deposited on 1996-03-01, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08200 (Start-415)
      • engineered (200)
      • engineered (331)
      • engineered (343-344)
      • engineered (350)
      • engineered (390)
      • engineered (394)
    Domains in SCOPe 2.07: d1isoa_
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1isoA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpmseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdeyalfeathgtapdiagqdkanpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtkdfeslmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1isoA (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
    mgvkkirfpehcgigikpmseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdeyalfeathgtapdiagqdkanpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtkdfeslmdgakllkcsefgdaiienm