PDB entry 1isn

View 1isn on RCSB PDB site
Description: Crystal structure of merlin FERM domain
Deposited on 2001-12-13, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isnA (A:)
    qpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkm
    dkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppea
    svllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrg
    rardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfp
    wneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrkadsle
    vqqmkaqareekarkqmerqrla