PDB entry 1isb

View 1isb on RCSB PDB site
Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Deposited on 1994-07-12, released 1994-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isbA (A:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaqvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isbB (B:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaqvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa