PDB entry 1isa

View 1isa on RCSB PDB site
Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Class: oxidoreductase(superoxide acceptor)
Keywords: oxidoreductase(superoxide acceptor)
Deposited on 1994-07-12, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron(II) superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1isaa1, d1isaa2
  • Chain 'B':
    Compound: iron(II) superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1isab1, d1isab2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isaA (A:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaqvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1isaB (B:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaqvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa