PDB entry 1is9

View 1is9 on RCSB PDB site
Description: Endoglucanase A from Clostridium thermocellum at atomic resolution
Deposited on 2001-11-26, released 2002-09-04
The last revision prior to the SCOP 1.65 freeze date was dated 2002-09-04, with a file datestamp of 2002-09-04.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.131
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1is9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is9A (A:)
    agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
    vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
    adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
    psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
    ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
    nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
    sdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is9A (A:)
    agvpfntkypygptsiavtamlkaewedwkskritsngaggykrvqrdastnydtvsegm
    gyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatdadedi
    alalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtnpsyfa
    pawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqsydyky
    datrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnhnasfi
    gpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnplsdl