PDB entry 1is8

View 1is8 on RCSB PDB site
Description: crystal structure of rat gtpchi/gfrp stimulatory complex plus zn
Deposited on 2001-11-18, released 2002-02-20
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1is8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1is8b_
  • Chain 'C':
    Domains in SCOP 1.67: d1is8c_
  • Chain 'D':
    Domains in SCOP 1.67: d1is8d_
  • Chain 'E':
    Domains in SCOP 1.67: d1is8e_
  • Chain 'F':
    Domains in SCOP 1.67: d1is8f_
  • Chain 'G':
    Domains in SCOP 1.67: d1is8g_
  • Chain 'H':
    Domains in SCOP 1.67: d1is8h_
  • Chain 'I':
    Domains in SCOP 1.67: d1is8i_
  • Chain 'J':
    Domains in SCOP 1.67: d1is8j_
  • Chain 'K':
    Domains in SCOP 1.67: d1is8k_
  • Chain 'L':
    Domains in SCOP 1.67: d1is8l_
  • Chain 'M':
    Domains in SCOP 1.67: d1is8m_
  • Chain 'N':
    Domains in SCOP 1.67: d1is8n_
  • Chain 'O':
    Domains in SCOP 1.67: d1is8o_
  • Chain 'P':
    Domains in SCOP 1.67: d1is8p_
  • Chain 'Q':
    Domains in SCOP 1.67: d1is8q_
  • Chain 'R':
    Domains in SCOP 1.67: d1is8r_
  • Chain 'S':
    Domains in SCOP 1.67: d1is8s_
  • Chain 'T':
    Domains in SCOP 1.67: d1is8t_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is8A (A:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8A (A:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1is8B (B:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8B (B:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1is8C (C:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8C (C:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1is8D (D:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8D (D:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1is8E (E:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8E (E:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1is8F (F:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8F (F:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1is8G (G:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8G (G:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1is8H (H:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8H (H:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1is8I (I:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8I (I:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1is8J (J:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is8J (J:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgkmnsktvtstmlgvfredp
    ktreefltlirs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8K (K:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8L (L:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8M (M:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8N (N:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8O (O:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8P (P:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8Q (Q:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8R (R:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8S (S:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is8T (T:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke