PDB entry 1is6

View 1is6 on RCSB PDB site
Description: MES-Liganded Congerin II
Class: sugar binding protein
Keywords: MES complex, BETA SANDWICH, SUGAR BINDING PROTEIN
Deposited on 2001-11-12, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1is6a_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is6A (A:)
    sdraevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is6A (A:)
    draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle