PDB entry 1is5

View 1is5 on RCSB PDB site
Description: Ligand free Congerin II
Class: sugar binding protein
Keywords: beta sandwich, sugar binding protein
Deposited on 2001-11-12, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1is5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is5A (A:)
    sdraevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is5A (A:)
    draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle