PDB entry 1is3

View 1is3 on RCSB PDB site
Description: lactose and mes-liganded congerin II
Class: sugar binding protein
Keywords: complex with lactose and mes, sugar binding protein
Deposited on 2001-11-12, released 2002-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1is3a_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is3A (A:)
    sdraevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is3A (A:)
    draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle