PDB entry 1is2

View 1is2 on RCSB PDB site
Description: Crystal Structure of Peroxisomal Acyl-CoA Oxidase-II from Rat Liver
Class: oxidoreductase
Keywords: Oxidoreductase, FAD
Deposited on 2001-11-07, released 2002-04-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA oxidase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1is2a1, d1is2a2, d1is2a3
  • Chain 'B':
    Compound: acyl-CoA oxidase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1is2b1, d1is2b2, d1is2b3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is2A (A:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
    erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
    gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
    kmdnyriprenmlmkyaqvkpdgtyvkplsnkltygtmvfvrsflvgnaaqslskactia
    irysavrrqseikqsepepqildfqtqqyklfpllatayafhfvgrymketylrinesig
    qgdlselpelhaltaglkafttwtanagieecrmacgghgyshssgipniyvtftpactf
    egentvmmlqtarflmkiydqvrsgklvggmvsylndlpsqriqpqqvavwptmvdinsl
    eglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyvvvkvfs
    dklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarilelltlir
    pnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhlkplqsk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is2A (A:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
    erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
    gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
    kmdnyriprenmlmkyaqvkpdgtyvkkltygtmvfvrsflvgnaaqslskactiairys
    avrrqseikqsepepqildfqtqqyklfpllatayafhfvgrymketylrinesigqgdl
    selpelhaltaglkafttwtanagieecrmacgghgyshssgipniyvtftpactfegen
    tvmmlqtarflmkiydqvrsgklvggmvsylndlpsvdinsleglteayklraarlveia
    aknlqthvshrkskevawnltsvdlvraseahchyvvvkvfsdklpkiqdkavqavlrnl
    cllyslygisqkggdflegsiitgaqlsqvnarilelltlirpnavalvdafdfkdmtlg
    svlgrydgnvyenlfewakksplnktevhesyhkhlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1is2B (B:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
    erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
    gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
    kmdnyriprenmlmkyaqvkpdgtyvkplsnkltygtmvfvrsflvgnaaqslskactia
    irysavrrqseikqsepepqildfqtqqyklfpllatayafhfvgrymketylrinesig
    qgdlselpelhaltaglkafttwtanagieecrmacgghgyshssgipniyvtftpactf
    egentvmmlqtarflmkiydqvrsgklvggmvsylndlpsqriqpqqvavwptmvdinsl
    eglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyvvvkvfs
    dklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarilelltlir
    pnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhlkplqsk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is2B (B:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
    erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
    gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
    kmdnyriprenmlmkyaqvkpdgtyvkmvfvrsflvgnaaqslskactiairysavrrqs
    eikqsepepqildfqtqqyklfpllatayafhfvgrymketylrinesigqgdlselpel
    haltaglkafttwtanagieecrmacgghgyshssgipniyvtftpactfegentvmmlq
    tarflmkiydqvrsgklvggmvsylndlvdinsleglteayklraarlveiaaknlqthv
    shrkskevawnltsvdlvraseahchyvvvkvfsdklpkiqdkavqavlrnlcllyslyg
    isqkggdflegsiitgaqlsqvnarilelltlirpnavalvdafdfkdmtlgsvlgrydg
    nvyenlfewakksplnktevhesyhkhlk