PDB entry 1is1

View 1is1 on RCSB PDB site
Description: Crystal structure of ribosome recycling factor from Vibrio parahaemolyticus
Class: translation
Keywords: translation
Deposited on 2001-11-05, released 2003-06-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Vibrio parahaemolyticus [TaxId:670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1is1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1is1A (A:)
mineikkdaqermdksvealknnlskvrtgrahpsllsgisveyygaatplnqvanvvae
dartlaitvfdkeltqkvekaimmsdlglnpmsagtiirvplpplteerrkdlvkivrge
aeggrvavrnirrdanndlkallkdkeisededrkaqeeiqkltdvavkkidevlaakek
elmev