PDB entry 1is0

View 1is0 on RCSB PDB site
Description: Crystal Structure of a Complex of the Src SH2 Domain with Conformationally Constrained Peptide Inhibitor
Class: transferase/transferase inhibitor
Keywords: conformationaly constrained INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2001-11-02, released 2002-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1is0a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1is0b_
  • Chain 'C':
    Compound: AY0 GLU GLU ILE peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1IS0
  • Chain 'D':
    Compound: AY0 GLU GLU ILE peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1IS0 (0-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1is0A (A:)
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptsk

    Sequence, based on observed residues (ATOM records): (download) 
    >1is0A (A:)
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1is0B (B:)
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptsk

    Sequence, based on observed residues (ATOM records): (download) 
    >1is0B (B:)
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.