PDB entry 1iry

View 1iry on RCSB PDB site
Description: Solution structure of the hMTH1, a nucleotide pool sanitization enzyme
Class: hydrolase
Keywords: nudix motif(G37-L59), HYDROLASE
Deposited on 2001-10-25, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hMTH1
    Species: Homo sapiens [TaxId:9606]
    Gene: hMTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1irya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iryA (A:)
    mgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
    vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
    sywfplllqkkkfhgyfkfqgqdtildytlrevdtv