PDB entry 1irx

View 1irx on RCSB PDB site
Description: Crystal structure of class I lysyl-tRNA synthetase
Class: ligase
Keywords: beta sandwitch, zinc-binding structure, Rossmann fold, alpha-helix cage, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2001-10-25, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57963 (Start-522)
      • conflict (123)
      • conflict (330)
    Domains in SCOPe 2.06: d1irxa1, d1irxa2
  • Chain 'B':
    Compound: lysyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57963 (Start-522)
      • conflict (123)
      • conflict (330)
    Domains in SCOPe 2.06: d1irxb1, d1irxb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1irxA (A:)
    mvhwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevr
    hihmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgi
    evdllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpeh
    rreaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdh
    lvagssydtgkeiikevygkeaplslmyefvgikgqkgkmsgskgnvillsdlyevlepg
    lvrfiyarhrpnkeikidlglgilnlydefekveriyfgveggkgddeelrrtyelsmpk
    kperlvaqapfrflavlvqlphlteediinvlikqghiprdlskedvervklrinlarnw
    vkkyapedvkfsilekppevevsedvreamnevaewlenheefsveefnnilfevakrrg
    issrewfstlyrlfigkergprlasflasldrsfvikrlrleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irxA (A:)
    hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
    hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
    dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
    eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
    agssydtgkeiikevygkeaplslmyefvgikgqnvillsdlyevlepglvrfiyarhrp
    nkeikidlglgilnlydefekveriyfgvegeelrrtyelsmpkkperlvaqapfrflav
    lvqlphlteediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsilek
    ppevevsedvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfig
    kergprlasflasldrsfvikrlrleg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1irxB (B:)
    mvhwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevr
    hihmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgi
    evdllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpeh
    rreaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdh
    lvagssydtgkeiikevygkeaplslmyefvgikgqkgkmsgskgnvillsdlyevlepg
    lvrfiyarhrpnkeikidlglgilnlydefekveriyfgveggkgddeelrrtyelsmpk
    kperlvaqapfrflavlvqlphlteediinvlikqghiprdlskedvervklrinlarnw
    vkkyapedvkfsilekppevevsedvreamnevaewlenheefsveefnnilfevakrrg
    issrewfstlyrlfigkergprlasflasldrsfvikrlrleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irxB (B:)
    hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
    hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
    dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
    eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
    agssydtgkeiikevygkeaplslmyefvgikgqnvillsdlyevlepglvrfiyarhrp
    nkeikidlglgilnlydefekveriyfgvegdeelrrtyelsmpkkperlvaqapfrfla
    vlvqlphlteediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsile
    kppevevsedvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfi
    gkergprlasflasldrsfvikrlrleg