PDB entry 1irv

View 1irv on RCSB PDB site
Description: cytochrome c isozyme 1, reduced, mutant with ile 75 replaced by met and cys 102 replaced by thr
Deposited on 1996-06-27, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1irv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1irv_ (-)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpxkympgtkmafgglkkekdrndlitylkkate

    Sequence, based on observed residues (ATOM records): (download) 
    >1irv_ (-)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkympgtkmafgglkkekdrndlitylkkate