PDB entry 1irv

View 1irv on RCSB PDB site
Description: cytochrome c isozyme 1, reduced, mutant with ile 75 replaced by met and cys 102 replaced by thr
Class: electron transport
Keywords: heme protein, mitochondrion, electron transport
Deposited on 1996-06-27, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • modified residue (76)
      • engineered (79)
      • engineered (106)
    Domains in SCOPe 2.07: d1irva_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irvA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkympgtkmafgglkkekdrndlitylkkate