PDB entry 1irs

View 1irs on RCSB PDB site
Description: irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure
Class: complex (signal transduction/peptide)
Keywords: phosphotyrosine binding domain (ptb), complex, signal transduction, complex (signal transduction/peptide)
Deposited on 1996-03-22, released 1997-05-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: irs-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTB DOMAIN OF IRS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1irsa_
  • Chain 'B':
    Compound: il-4 receptor phosphopeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24394 (0-10)
      • modified residue (8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irsA (A:)
    mgpafkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcg
    hsenfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdefrpr
    

  • Chain 'B':
    No sequence available.