PDB entry 1irs

View 1irs on RCSB PDB site
Description: irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure
Deposited on 1996-03-22, released 1997-05-15
The last revision prior to the SCOP 1.69 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1irsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1irsA (A:)
  mgpafkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcg
  hsenfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdefrpr