PDB entry 1irq

View 1irq on RCSB PDB site
Description: Crystal structure of omega transcriptional repressor at 1.5A resolution
Class: gene regulation
Keywords: transcriptional repressor, ribbon-helix-helix
Deposited on 2001-10-11, released 2001-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.211
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: omega transcriptional repressor
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1irqa_
  • Chain 'B':
    Compound: omega transcriptional repressor
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1irqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1irqA (A:)
mivgnlgaqkakrndtpisakkdimgdktvrvradlhhiikietaknggnvkevmdqale
eyirkylpdkl

    Sequence, based on observed residues (ATOM records): (download) 
    >1irqA (A:)
imgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1irqB (B:)
mivgnlgaqkakrndtpisakkdimgdktvrvradlhhiikietaknggnvkevmdqale
eyirkylpdkl

    Sequence, based on observed residues (ATOM records): (download) 
    >1irqB (B:)
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl